PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID cra_locus_15360_iso_1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
Family MYB
Protein Properties Length: 397aa    MW: 42955.9 Da    PI: 6.8521
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
cra_locus_15360_iso_1genomeMPGR-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding55.11.8e-172671147
                                          TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
                       Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                                          +g+W++eEd +l ++v  +G ++W++Iar ++ gR++k+c++rw + 
  cra_locus_15360_iso_1_len_2072_ver_3 26 KGPWSPEEDAILSRLVSNFGARNWSLIARGIP-GRSGKSCRLRWCNQ 71
                                          79******************************.***********985 PP

2Myb_DNA-binding57.53.2e-1878122147
                                           TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
                       Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                                           r+++T++Ed ++++a++ +G++ W++Iar ++ gRt++ +k++w++ 
  cra_locus_15360_iso_1_len_2072_ver_3  78 RKPFTEDEDRIILQAHAIHGNK-WASIARLLP-GRTDNAIKNHWNST 122
                                           789*******************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129419.4262172IPR017930Myb domain
SuperFamilySSF466897.55E-3123119IPR009057Homeodomain-like
SMARTSM007177.1E-152574IPR001005SANT/Myb domain
PfamPF002491.0E-162671IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.3E-262779IPR009057Homeodomain-like
CDDcd001673.43E-142870No hitNo description
PROSITE profilePS5129427.68373127IPR017930Myb domain
SMARTSM007171.4E-1777125IPR001005SANT/Myb domain
PfamPF002495.3E-1678122IPR001005SANT/Myb domain
CDDcd001671.56E-1380123No hitNo description
Gene3DG3DSA:1.10.10.609.4E-2480126IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009751Biological Processresponse to salicylic acid
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 397 aa     Download sequence    Send to blast
XGSGGGGGGS SSSSSQVSKK SLDRVKGPWS PEEDAILSRL VSNFGARNWS LIARGIPGRS  60
GKSCRLRWCN QLDPAVKRKP FTEDEDRIIL QAHAIHGNKW ASIARLLPGR TDNAIKNHWN  120
STLRRRCIDP SKFKFESSNV LEDVSVEKSK GSSDETLSCG DVNSLKSLEG RDITSNENID  180
DDLYEGKTQI GDKTQTEIQC NPEPKDPPTL FRPRARISAF SVYSPVDVVE TSLPSAVAVS  240
SQGPLDQVPR PEAGISKLLQ GAYSDRLIPY QCGHGCCMSP DGGKLHSSLL GPEFVDYTEP  300
LSFPSHELAT LAADISNAAW RRSGLESICV KPLESAASAL PFISSHLQMG YPEEGMRTDG  360
LQFDKGTSSL AGMFSDALSN PLRMQAMQIN ANVGSRI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-42231264107B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00337DAPTransfer from AT3G09230Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011094946.11e-162PREDICTED: uncharacterized protein LOC105174515
TrEMBLA0A068UFY21e-167A0A068UFY2_COFCA; Uncharacterized protein
STRINGVIT_08s0007g01540.t011e-157(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA26112454